PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BES1
Protein Properties Length: 332aa    MW: 35617.6 Da    PI: 8.6963
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767052.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822208.22.2e-64371663133
          DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqss 97 
                     ++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk +DnneVlkALc+eAGw+ve+DGtty+kg+kp+  +e++g+sa+++ +ss + s
  XP_009767052.1  37 GRRKPSWRERENNRRRERRRRAMAAKIYTGLRAQGNYNLPKNCDNNEVLKALCAEAGWIVEPDGTTYPKGCKPT-PMEIGGTSANITLSSSWNPS 130
                     79************************************************************************.******************** PP

          DUF822  98 lkssalaspvesysaspksssfpspssldsislasa 133
                     ++ss++asp++sy++s++sssfpsps++d ++++ +
  XP_009767052.1 131 PQSSYFASPIPSYQPSLTSSSFPSPSRADANMSSYP 166
                     *****************************9987643 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.9E-5937162IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MMGEAGGGST ASSSAAGSGG GSGGAGVGLS ESGSNCGRRK PSWRERENNR RRERRRRAMA  60
AKIYTGLRAQ GNYNLPKNCD NNEVLKALCA EAGWIVEPDG TTYPKGCKPT PMEIGGTSAN  120
ITLSSSWNPS PQSSYFASPI PSYQPSLTSS SFPSPSRADA NMSSYPFAFL HNVIPSSLPP  180
LRISNSAPVT PPLSSPTRHP KQTFNLETLA KESMSALNIP FFAASAPASP TRGRRFTPPT  240
IPECDESDTS TIDSGQWINF QKYATNVPTS PTFNLVKPVS QPLRSYDIIT EKGKSIEFDF  300
ENVSVKAWEG ERIHDVGFDD LELTLGNGSA RV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13756RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3959010.0AF395901.1 Lycopersicon esculentum mature anther-specific protein LAT61 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-115BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM1B8X31e-172M1B8X3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-171(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-99BES1 family protein